PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013616103.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 308aa    MW: 34312.4 Da    PI: 4.9022
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013616103.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  v+++G   W+t +++ g++R++k+c++rw +yl
   XP_013616103.1 14 KGAWTPEEDQRLIAFVQLHGESGWRTLPEKAGLKRCGKSCRLRWANYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.16.4e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+eEd+ ++++++++G++ W++Ia  +  gRt++++k++w++ 
   XP_013616103.1  67 RGEFTPEEDDTIIKLHALMGNK-WAAIATSLA-GRTDNEIKNYWNTN 111
                      899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.634961IPR017930Myb domain
SuperFamilySSF466894.12E-2911108IPR009057Homeodomain-like
SMARTSM007172.2E-121363IPR001005SANT/Myb domain
PfamPF002492.1E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-231568IPR009057Homeodomain-like
CDDcd001671.81E-91661No hitNo description
PROSITE profilePS5129425.27762116IPR017930Myb domain
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002495.0E-1567112IPR001005SANT/Myb domain
CDDcd001671.46E-1169112No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MVRTPCCKEE GIRKGAWTPE EDQRLIAFVQ LHGESGWRTL PEKAGLKRCG KSCRLRWANY  60
LKPDIKRGEF TPEEDDTIIK LHALMGNKWA AIATSLAGRT DNEIKNYWNT NLKKRLTQKG  120
LDPTTHKPIN PTDQTGFEPK VHKLGSSSCA RLLNHVARKY AGDLNRDLLT GIIIGNSSNI  180
AEGSQNSVEV DSPTESSTFT LLNKAAARSS AVTSFLTNNM SSSSGLSNNC TLADNLDLFF  240
SNEEISDMSM NVDNVCIMEE LRDILSYGGA DAGDVKDLPE FDVTDGMEFL GSWNVEDDLD  300
LENYYWFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013616108.10.0PREDICTED: transcription factor MYB34-like
RefseqXP_013616107.10.0PREDICTED: transcription factor MYB34-like
RefseqXP_013616105.10.0PREDICTED: transcription factor MYB34-like
RefseqXP_013616104.10.0PREDICTED: transcription factor MYB34-like
RefseqXP_013616103.10.0PREDICTED: transcription factor MYB34-like
RefseqXP_013616102.10.0PREDICTED: transcription factor MYB34-like
SwissprotO643991e-147MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A0D3AY340.0A0A0D3AY34_BRAOL; Uncharacterized protein
STRINGBra029350.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60890.11e-142myb domain protein 34